PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00011792-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family MYB_related
Protein Properties Length: 288aa    MW: 31355.2 Da    PI: 9.935
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00011792-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.82.4e-1376120347
                         SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
     Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                         +WT++E+ l++ + ++ G+g+W+ I+r + k+Rt+ q+ s+ qky
  WALNUT_00011792-RA  76 PWTEDEHRLFLLGLQKVGKGDWRGISRNFVKTRTPTQVASHAQKY 120
                         8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.62169125IPR017930Myb domain
SuperFamilySSF466891.57E-1671125IPR009057Homeodomain-like
TIGRFAMsTIGR015572.5E-1772123IPR006447Myb domain, plants
SMARTSM007176.8E-1073123IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.3E-1175120IPR009057Homeodomain-like
CDDcd001675.17E-976121No hitNo description
PfamPF002491.6E-1076120IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 288 aa     Download sequence    Send to blast
MKKMSPRACA DAGCVDNGIM LFGVRVTEGN SFRKSASMTN LSQYDQQPQD SNVEAGYASD  60
DVVPSGGGRE RKRGVPWTED EHRLFLLGLQ KVGKGDWRGI SRNFVKTRTP TQVASHAQKY  120
FLRRTNQNRR RRRSSLFDIT ADTFPGSSID EDQVYHETVP LPKPQPQLSH NFGGFPMPNF  180
PVALAPSVVP LAVENPLENL SLGPSNHTRT SSKPIRPTPI LPVPPSLKMA DLNLNQNTNT  240
DPSLPLSLKL STASSGEQSP PATHSSTFQV TPGNFSSSTT GDSIISVA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006438524.11e-113hypothetical protein CICLE_v10032167mg
TrEMBLA0A067GVG81e-115A0A067GVG8_CITSI; Uncharacterized protein
STRINGVIT_01s0026g01050.t011e-111(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF53383350
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.24e-61MYB_related family protein